PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G374100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 266aa    MW: 29038.6 Da    PI: 5.2677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G374100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+ Ed +lv +++++G g W + +r+ g++R++k+c++rw++yl
  Sevir.9G374100.1.p 14 RGAWTAMEDGILVSYIQKHGEGKWGSLPRRAGLKRCGKSCRLRWLNYL 61
                        89********************************************97 PP

2Myb_DNA-binding52.61.1e-1667111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ +++E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Sevir.9G374100.1.p  67 RGNISEDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                         7899******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.232961IPR017930Myb domain
SuperFamilySSF466896.12E-2812108IPR009057Homeodomain-like
SMARTSM007171.4E-111363IPR001005SANT/Myb domain
PfamPF002496.2E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-211568IPR009057Homeodomain-like
CDDcd001676.67E-91661No hitNo description
PROSITE profilePS5129425.34862116IPR017930Myb domain
SMARTSM007177.9E-1666114IPR001005SANT/Myb domain
PfamPF002496.3E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2469116IPR009057Homeodomain-like
CDDcd001674.52E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRKPSCSKE GMNRGAWTAM EDGILVSYIQ KHGEGKWGSL PRRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SEDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKKVLRNS  120
GRSKEDNQAA PEQEASPVAV RSKALRCTAR LPVVQVQPAA PASHGCPSET AVGDDGVREE  180
QAADEAAPAP AVEVQQKQLD FLPEDELSID LDFDMGELGF LSPWRGEVGG GVGPGDRFDG  240
DEVDDLEALL LGPGGDGNLH EFAWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886191e-100D88619.1 Oryza sativa mRNA for OSMYB3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986909.10.0PREDICTED: myb-related protein 308-like
SwissprotQ9FJA24e-63TT2_ARATH; Transcription factor TT2
TrEMBLK4AJ410.0K4AJ41_SETIT; Uncharacterized protein
STRINGSi038905m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.15e-53MYB family protein